Proteintech, 68349-1-Ig, AP2B1 Monoclonal antibody

Size: 20ul / 150ul The AP2B1 (68349-1-Ig) by Proteintech is a Monoclonal antibody targeting AP2B1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit, Pig samples 68349-1-Ig targets AP2B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples. Tested Applications Positive WB detected in: pig cerebellum tissue, HeLa cells, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis. Specification Tested Reactivity: Human, Mouse, Rat, Rabbit, Pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8264 Product name: Recombinant human AP2B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 598-951 aa of BC006201 Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN Predict reactive species Full Name: adaptor-related protein complex 2, beta 1 subunit Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 100-115 kDa GenBank Accession Number: BC006201 Gene Symbol: AP2B1 Gene ID (NCBI): 163 RRID: AB_3085072 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P63010 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.