Iright
BRAND / VENDOR: Proteintech

Proteintech, 68367-1-Ig, MITD1 Monoclonal antibody

CATALOG NUMBER: 68367-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MITD1 (68367-1-Ig) by Proteintech is a Monoclonal antibody targeting MITD1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 68367-1-Ig targets MITD1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: MCF-7 cells, Saos-2 cells, U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11237 Product name: Recombinant human MITD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-249 aa of BC018453 Sequence: MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI Predict reactive species Full Name: MIT, microtubule interacting and transport, domain containing 1 Calculated Molecular Weight: 249 aa, 29 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC018453 Gene Symbol: MITD1 Gene ID (NCBI): 129531 RRID: AB_3085087 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8WV92 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924