Proteintech, 68391-1-Ig, HDDC2 Monoclonal antibody

Size: 20ul / 150ul The HDDC2 (68391-1-Ig) by Proteintech is a Monoclonal antibody targeting HDDC2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 68391-1-Ig targets HDDC2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells Positive IHC detected in: mouse kidney tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Saos-2 cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information HDDC2, also named as C6orf74, plays a role in the maintenance of pluripotency in human ES and iPS cells. HDDC2 is a nuclear‐encoded but mitochondrially localized protein. It has been reported as associated with oxidative metabolism. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33258 Product name: Recombinant human HDDC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 15-218 aa of BC003357 Sequence: MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS Predict reactive species Full Name: HD domain containing 2 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC003357 Gene Symbol: HDDC2 Gene ID (NCBI): 51020 RRID: AB_3085109 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7Z4H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.