Proteintech, 68408-1-Ig, ISG15 Monoclonal antibody

Size: 20ul / 150ul The ISG15 (68408-1-Ig) by Proteintech is a Monoclonal antibody targeting ISG15 in WB, ELISA applications with reactivity to Human samples 68408-1-Ig targets ISG15 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, LNCaP cells, A431 cells, HeLa cells, HCT 116 cells, HeLa cells, DU 145 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8953 Product name: Recombinant human ISG15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-165 aa of BC009507 Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Predict reactive species Full Name: ISG15 ubiquitin-like modifier Calculated Molecular Weight: 165 aa, 18 kDa Observed Molecular Weight: 13-17 kDa GenBank Accession Number: BC009507 Gene Symbol: ISG15 Gene ID (NCBI): 9636 RRID: AB_3085125 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05161 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.