Proteintech, 68430-1-Ig, Synaptotagmin-9 Monoclonal antibody

Size: 20ul / 150ul The Synaptotagmin-9 (68430-1-Ig) by Proteintech is a Monoclonal antibody targeting Synaptotagmin-9 in WB, ELISA applications with reactivity to human, mouse, rat, rabbit samples 68430-1-Ig targets Synaptotagmin-9 in WB, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: rabbit retina tissue, rat retina tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-9 (SYT9) is a tandem C2 domain Ca 2+ sensor for exocytosis in neuroendocrine cells (PMID: 36732068). Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33194 Product name: Recombinant human SYT9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-319 aa of BC029605 Sequence: LCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNILR Predict reactive species Full Name: synaptotagmin IX Calculated Molecular Weight: 491 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC029605 Gene Symbol: Synaptotagmin-9 Gene ID (NCBI): 143425 RRID: AB_3085144 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86SS6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.