Proteintech, 68511-1-Ig, POLR2F Monoclonal antibody

Size: 20ul / 150ul The POLR2F (68511-1-Ig) by Proteintech is a Monoclonal antibody targeting POLR2F in WB, ELISA applications with reactivity to Human, mouse samples 68511-1-Ig targets POLR2F in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, NIH/3T3 cells, MCF-7 cells, A549 cells, HeLa cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7472 Product name: Recombinant human POLR2F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-127 aa of BC003582 Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD Predict reactive species Full Name: polymerase (RNA) II (DNA directed) polypeptide F Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC003582 Gene Symbol: POLR2F Gene ID (NCBI): 5435 RRID: AB_3085220 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61218 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.