Proteintech, 68515-1-Ig, DSG2 Monoclonal antibody

Size: 20ul / 150ul The DSG2 (68515-1-Ig) by Proteintech is a Monoclonal antibody targeting DSG2 in WB, ELISA applications with reactivity to human samples 68515-1-Ig targets DSG2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, K-562 cells, A549 cells, LNCaP cells, MCF-7 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. Desmosomal cadherins, consisting of four desmogleins (DSG1-4) and three desmocollins (DSC1-3) in humans, mediate adhesion through calcium-dependent homophilic/heterophilic interactions. DSG2 is a single-pass transmembrane glycoprotein that is widely expressed in epithelial and non-epithelial tissues, such as the intestine, epidermis, testis, and heart (PMID:21715983). Defects in DSG2 are the cause of familial arrhythmogenic right ventricular dysplasia type 10 (ARVD10), and genetic variations in DSG2 are the cause of susceptibility to cardiomyopathy dilated type 1BB (CMD1BB). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20633 Product name: Recombinant human DSG2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 345-608 aa of BC099655 Sequence: MKNLDFSVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDTGLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYV Predict reactive species Full Name: desmoglein 2 Calculated Molecular Weight: 1118 aa, 122 kDa Observed Molecular Weight: 145-150 kDa GenBank Accession Number: BC099655 Gene Symbol: DSG2 Gene ID (NCBI): 1829 RRID: AB_3085224 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14126 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.