Proteintech, 68549-1-Ig, SUCLA2 Monoclonal antibody

Size: 20ul / 150ul The SUCLA2 (68549-1-Ig) by Proteintech is a Monoclonal antibody targeting SUCLA2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 68549-1-Ig targets SUCLA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, mouse brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Caco-2 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information SUCLA2, β subunit of succinate-CoA ligase, contributes to energy production in mitochondria through the succinate-CoA ligase enzyme. Succinate-CoA ligase catalyses the reversible conversion of succinyl-CoA and ADP or GDP to succinate and ATP or GTP. SUCLA2 mutations cause global protein succinylation and mitochondrial DNA depletion (PMID: 33230181, PMID: 20301762). Mutations in SUCLA2 are also associated with SUCLA2-related mitochondrial DNA depletion syndrome, leigh syndrome, down syndrome (PMID: 23010432). Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17967 Product name: Recombinant human SUCLA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-353 aa of BC027587 Sequence: AQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGAT Predict reactive species Full Name: succinate-CoA ligase, ADP-forming, beta subunit Calculated Molecular Weight: 463 aa, 50 kDa Observed Molecular Weight: 48-50 kDa GenBank Accession Number: BC027587 Gene Symbol: SUCLA2 Gene ID (NCBI): 8803 RRID: AB_3670383 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P2R7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.