Proteintech, 68554-1-Ig, STARD10 Monoclonal antibody

Size: 20ul / 150ul The STARD10 (68554-1-Ig) by Proteintech is a Monoclonal antibody targeting STARD10 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68554-1-Ig targets STARD10 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: SK-BR-3 cells, MCF-7 cells, T-47D cells, LNCaP cells, rat liver tissue, mouse liver tissue, pig liver tissue, rabbit liver tissue, rabbit testis tissue Positive IP detected in: HepG2 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information STARD10 (START domain-containing protein 10, also known as PCTP-like protein) is highly expressed in liver and responsible to transfer phosphatidylcholine. STARD10 was identified as a protein overexpressed in breast cancer that cooperates with the ErbB family of receptor tyrosine kinases in cellular transformation (PMID: 15911624). This antibody detected duplicate bands between 35-40 kDa (PMID: 15150109). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10932 Product name: Recombinant human STARD10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-291 aa of BC007919 Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT Predict reactive species Full Name: StAR-related lipid transfer (START) domain containing 10 Calculated Molecular Weight: 291 aa, 33 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC007919 Gene Symbol: STARD10 Gene ID (NCBI): 10809 RRID: AB_3085257 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y365 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.