Proteintech, 68575-1-Ig, IFI44 Monoclonal antibody

Size: 20ul / 150ul The IFI44 (68575-1-Ig) by Proteintech is a Monoclonal antibody targeting IFI44 in WB, ELISA applications with reactivity to Human samples 68575-1-Ig targets IFI44 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HeLa cells, Calu-3 cells, SW1990 cells, LNCaP cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33799 Product name: Recombinant human IFI44 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 9-175 aa of BC022870 Sequence: RLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALR Predict reactive species Full Name: interferon-induced protein 44 Calculated Molecular Weight: 444 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC022870 Gene Symbol: IFI44 Gene ID (NCBI): 10561 RRID: AB_3085275 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8TCB0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.