Iright
BRAND / VENDOR: Proteintech

Proteintech, 68621-1-Ig, PRODH Monoclonal antibody

CATALOG NUMBER: 68621-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRODH (68621-1-Ig) by Proteintech is a Monoclonal antibody targeting PRODH in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68621-1-Ig targets PRODH in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: mouse liver tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PRODH(Proline dehydrogenase 1, mitochondrial) is also named as PIG6, HSPOX2, PRODH1, PRODH2, POX, SCZD4, TP53I6 and belongs to the proline oxidase family. It is an oxidoreductase involved in the transfer of redox potential across the mitochondrial membrane and catalyzes the rate-limiting oxidation of proline to pyrroline- 5-carboxylate (P5C). High PRODH activity is sufficient to induce mitochondria-mediated apoptosis in the presence of proline. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1) and defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). This protein has 3 isoforms produced by alternative splicing with the molecular mass of 68 kDa, 59 kDa and 56 kDa. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18429 Product name: Recombinant human PRODH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 143-492 aa of BC118597 Sequence: LAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA Predict reactive species Full Name: proline dehydrogenase (oxidase) 1 Calculated Molecular Weight: 600 aa, 68 kDa Observed Molecular Weight: 56 kDa, 66 kDa GenBank Accession Number: BC118597 Gene Symbol: PRODH Gene ID (NCBI): 5625 RRID: AB_3085313 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43272 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924