Product Description
Size: 20ul / 150ul
The ZC3H12D (68847-1-Ig) by Proteintech is a Monoclonal antibody targeting ZC3H12D in WB, ELISA applications with reactivity to human samples
68847-1-Ig targets ZC3H12D in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Karpas-422 cells, MJ cells, Raji cells, Ramos cells, Daudi cells, THP-1 cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines.
Specification
Tested Reactivity: human
Host / Isotype: Mouse / IgG2b
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag21770 Product name: Recombinant human ZC3H12D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC157832 Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR Predict reactive species
Full Name: zinc finger CCCH-type containing 12D
Calculated Molecular Weight: 527 aa, 58 kDa
Observed Molecular Weight: 52 kDa
GenBank Accession Number: BC157832
Gene Symbol: ZC3H12D
Gene ID (NCBI): 340152
RRID: AB_3670440
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: A2A288
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924