Iright
BRAND / VENDOR: Proteintech

Proteintech, 80919-2-RR, Ataxin 2 Recombinant monoclonal antibody

CATALOG NUMBER: 80919-2-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Ataxin 2 (80919-2-RR) by Proteintech is a Recombinant antibody targeting Ataxin 2 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 80919-2-RR targets Ataxin 2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, Neuro-2a cells Positive IP detected in: NIH/3T3 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information ATXN2 contains a repeat structure with 22 or 23 triplets coding for glutamine and the (CAG)8CAA(CAG)4CAA(CAG)8 sequence; expansion of this domain to a size ≥34 triplets with a pure CAG sequence primarily causes autosomal dominant SCA2 [PMID:18418684], while ATXN2 expansions with CAA interruptions were observed as the cause of Levo-dopa responsive Parkinson's disease [PMID:10668726]. ATXN2 expansions associated with ALS were reported to be interrupted by at least one CAA triplet [PMID:21537950] Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16470 Product name: Recombinant human Ataxin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-600 aa of BC114546 Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS Predict reactive species Full Name: ataxin 2 Calculated Molecular Weight: 1313 aa, 140 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC114546 Gene Symbol: ATXN2 Gene ID (NCBI): 6311 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99700 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924