Iright
BRAND / VENDOR: Proteintech

Proteintech, 81083-1-RR, AFP Recombinant monoclonal antibody

CATALOG NUMBER: 81083-1-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The AFP (81083-1-RR) by Proteintech is a Recombinant antibody targeting AFP in WB, IHC, ELISA applications with reactivity to human samples 81083-1-RR targets AFP in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, human placenta tissue Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AFP (Alpha-fetoprotein) is a major plasma protein in the fetus and its concentration is very low in the adult (PMID:24120489). AFP can be detected at abnormally high concentrations in hepatocellular carcinomas as well as in the plasma and ascitic fluid of adults with hepatoma, indicating that AFP can serve as a tumor marker (PMID: 18669658). AFP is also a glycosylated protein and based on its binding capability to lectin Lens Culinaris Agglutinin (LCA), and total AFP can be separated into three different glycoforms, AFP-L1, AFP-L2, and AFP-L3. Core-fucosylated form of AFP (AFP-L3) is a more specific indicator than total AFP for HCC (PMID: 33128033, 35458505) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6089 Product name: Recombinant human AFP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-609 aa of BC027881 Sequence: LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV Predict reactive species Full Name: alpha-fetoprotein Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 68-72 kDa GenBank Accession Number: BC027881 Gene Symbol: AFP Gene ID (NCBI): 174 RRID: AB_2923701 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924