Proteintech, 81324-1-RR, CD3 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD3 (81324-1-RR) by Proteintech is a Recombinant antibody targeting CD3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 81324-1-RR targets CD3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells, pig thymus tissue, rat thymus tissue, mouse thymus tissue Positive IHC detected in: human colon tissue, human tonsillitis tissue, mouse small intestine tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue, mouse small intestine tissue, human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This antibody is directed against the epsilon chain of human CD3 molecule. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11797 Product name: Recombinant human CD3E protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-207 aa of BC049847 Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Predict reactive species Full Name: CD3e molecule, epsilon (CD3-TCR complex) Calculated Molecular Weight: 207 aa, 23 kDa Observed Molecular Weight: 23-25 kDa GenBank Accession Number: BC049847 Gene Symbol: CD3 Gene ID (NCBI): 916 ENSEMBL Gene ID: ENSG00000198851 RRID: AB_2935548 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07766 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.