Proteintech, 81377-1-RR, EEF1A1 Recombinant monoclonal antibody

Size: 20ul / 100ul The EEF1A1 (81377-1-RR) by Proteintech is a Recombinant antibody targeting EEF1A1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 81377-1-RR targets EEF1A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse brain tissue, human pancreas cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EEF1A1, also named as EEF1A, EF1A and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.1 It is a typical housekeeping gene product required for the maintenance of cell proliferation and/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1938 Product name: Recombinant human EEF1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-462 aa of BC014224 Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK Predict reactive species Full Name: eukaryotic translation elongation factor 1 alpha 1 Calculated Molecular Weight: 462 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC014224 Gene Symbol: EEF1A1 Gene ID (NCBI): 1915 RRID: AB_2935549 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P68104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.