Iright
BRAND / VENDOR: Proteintech

Proteintech, 81490-5-RR, PPAR Gamma Recombinant monoclonal antibody

CATALOG NUMBER: 81490-5-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PPAR Gamma (81490-5-RR) by Proteintech is a Recombinant antibody targeting PPAR Gamma in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 81490-5-RR targets PPAR Gamma in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HepG2 cells, L02 cells, C6 cells Positive IHC detected in: human placenta tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat liver tissue Positive FC (Intra) detected in: HeLa cells, K562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Peroxisome Proliferator-Activated Receptors (PPARs) are ligand-activated intracellular transcription factors, members of the nuclear hormone receptor superfamily (NR), that includes estrogen, thyroid hormone receptors, retinoic acid, Vitamin D3 as well as retinoid X receptors (RXRs). The PPAR subfamily consists of three subtypes encoded by distinct genes denoted PPARα (NR1C1), PPARβ/δ (NR1C2) and PPARγ (NR1C3), which are activated by selective ligands. PPARγ, also named as PPARG, contains one nuclear receptor DNA-binding domain and is a receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. It plays an important role in the regulation of lipid homeostasis, adipogenesis, ins resistance, and development of various organs. Defects in PPARG are the cause of familial partial lipodystrophy type 3 (FPLD3) and may be associated with susceptibility to obesity. Defects in PPARG can lead to type 2 ins-resistant diabetes and hypertension. PPARG mutations may be associated with colon cancer. Genetic variations in PPARG are associated with susceptibility to glioma type 1 (GLM1). PPARG has two isoforms with molecular weights of 57 kDa and 54 kDa (PMID: 9831621), but modified PPARG is about 67 KDa (PMID: 16809887). PPARG2 is a splice variant and has an additional 30 amino acids at the N-terminus (PMID: 15689403). Experimental data indicate that a 45 kDa protein displaying three different sequences immunologically related to the nuclear receptor PPARG2 is located in mitochondria (mt-PPAR). However, the molecular weight of this protein is clearly less when compared to that of PPARG2 (57 kDa) (PMID: 10922459). PPARG has been reported to be localized mainly (but not always) in the nucleus. PPARG can also be detected in the cytoplasm and was reported to possess extra-nuclear/non-genomic actions (PMID: 17611413; 19432669; 14681322). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10005 Product name: Recombinant human PPARG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-477 aa of BC006811 Sequence: KCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY Predict reactive species Full Name: peroxisome proliferator-activated receptor gamma Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC006811 Gene Symbol: PPARG Gene ID (NCBI): 5468 RRID: AB_3670497 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P37231 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924