Proteintech, 81570-1-RR, MYL7 Recombinant monoclonal antibody

Size: 20ul / 100ul The MYL7 (81570-1-RR) by Proteintech is a Recombinant antibody targeting MYL7 in WB, IHC, ELISA applications with reactivity to mouse, rat, human samples 81570-1-RR targets MYL7 in WB, IHC, ELISA applications and shows reactivity with mouse, rat, human samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information MYL7, also known as myosin light chain 2a (MLC2a), is essential for heart development. The expression of MYL7 in heart is predominatantly restricted to the atrium. So its expression has been considered as useful marker for atrial cardiomyocytes. Specification Tested Reactivity: mouse, rat, human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11058 Product name: Recombinant human MYL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC027915 Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE Predict reactive species Full Name: myosin, light chain 7, regulatory Calculated Molecular Weight: 175 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC027915 Gene Symbol: MYL7 Gene ID (NCBI): 58498 RRID: AB_2935563 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q01449 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.