Proteintech, 81984-2-RR, Histone H3 Recombinant monoclonal antibody

Size: 100ul The Histone H3 (81984-2-RR) by Proteintech is a Recombinant antibody targeting Histone H3 in WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples 81984-2-RR targets Histone H3 in WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, mouse brain tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HepG2 cells Positive ChIP-qPCR detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10644 Product name: Recombinant human Histone-H3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-136 aa of BC015544 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species Full Name: histone cluster 2, H3a Calculated Molecular Weight: 136 aa, 15 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC015544 Gene Symbol: Histone H3 Gene ID (NCBI): 333932 RRID: AB_3670510 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q71DI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.