Proteintech, 82491-1-RR, LASP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The LASP1 (82491-1-RR) by Proteintech is a Recombinant antibody targeting LASP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 82491-1-RR targets LASP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, SKOV-3 cells, PC-3 cells, HCT 116 cells, Jurkat cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0800 Product name: Recombinant human LASP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species Full Name: LIM and SH3 protein 1 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC012460 Gene Symbol: LASP1 Gene ID (NCBI): 3927 ENSEMBL Gene ID: ENSG00000002834 RRID: AB_3086483 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14847 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.