Proteintech, 82585-1-RR, NAT10 Recombinant monoclonal antibody

Size: 20ul / 100ul The NAT10 (82585-1-RR) by Proteintech is a Recombinant antibody targeting NAT10 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 82585-1-RR targets NAT10 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IP detected in: mouse testis tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:1500-1:6000 Background Information NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. The specificity of this antibody has been tested by siRNA (PMID: 24786082). NAT10 regulates mitotic cell fate by acetylating Eg5. NAT10 depletion results in multinuclear giant cells, which is the hallmark of mitotic catastrophe (PMID: 35210604). NAT10 plays a crucial role in carcinogenesis through influencing EMT, hypoxia, ribosomal biogenesis and overall, promoting translational efficiency. Recently, we reported that treating cancer cells with Remodelin, a small molecule inhibitor of NAT10, causes alteration in global lipid metabolism (PMID: 36149760). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4184 Product name: Recombinant human NAT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 676-1025 aa of BC035558 Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK Predict reactive species Full Name: N-acetyltransferase 10 (GCN5-related) Calculated Molecular Weight: 1025 aa, 116 kDa Observed Molecular Weight: 116 kDa GenBank Accession Number: BC035558 Gene Symbol: NAT10 Gene ID (NCBI): 55226 RRID: AB_3086490 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H0A0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.