Proteintech, 82829-1-RR, CLOCK Recombinant monoclonal antibody

Size: 20ul / 100ul The CLOCK (82829-1-RR) by Proteintech is a Recombinant antibody targeting CLOCK in WB, IHC, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples 82829-1-RR targets CLOCK in WB, IHC, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, HEK-293 cells, A431 cells, PC-3 cells, NIH/3T3 cells, rat testis tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive ChIP-qPCR detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information Circadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. The calculated molecular weight of CLOCK is 95kDa, we detected a 95-110 kDa protein by western blot. Our result is similar to the result of reseach paper (PMID: 30683868). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30011 Product name: Recombinant human CLOCK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC041878 Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFISNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWL Predict reactive species Full Name: clock homolog (mouse) Calculated Molecular Weight: 846 aa, 95 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC041878 Gene Symbol: CLOCK Gene ID (NCBI): 9575 RRID: AB_3086549 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15516 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.