Iright
BRAND / VENDOR: Proteintech

Proteintech, 82886-2-RR, IFT88 Recombinant monoclonal antibody

CATALOG NUMBER: 82886-2-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IFT88 (82886-2-RR) by Proteintech is a Recombinant antibody targeting IFT88 in WB, IF/ICC, ELISA applications with reactivity to human samples 82886-2-RR targets IFT88 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, PC-3 cells Positive IF/ICC detected in: Starvation treated hTERT-RPE1 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4980 Product name: Recombinant human IFT88 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 532-833 aa of BC030776 Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE Predict reactive species Full Name: intraflagellar transport 88 homolog (Chlamydomonas) Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 88-95 kDa GenBank Accession Number: BC030776 Gene Symbol: IFT88 Gene ID (NCBI): 8100 RRID: AB_3670605 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13099 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924