Proteintech, 83057-2-RR, GABRA2 Recombinant monoclonal antibody

Size: 20ul / 100ul The GABRA2 (83057-2-RR) by Proteintech is a Recombinant antibody targeting GABRA2 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83057-2-RR targets GABRA2 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, mouse brain tissue, rat brain tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29301 Product name: Recombinant human GABRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 348-412 aa of NM_000807 Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN Predict reactive species Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 2 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 50-51 kDa GenBank Accession Number: NM_000807 Gene Symbol: GABRA2 Gene ID (NCBI): 2555 RRID: AB_3670783 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P47869 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.