Proteintech, 83129-5-RR, HNRPDL Recombinant monoclonal antibody

Size: 20ul / 100ul The HNRPDL (83129-5-RR) by Proteintech is a Recombinant antibody targeting HNRPDL in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83129-5-RR targets HNRPDL in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, Raji cells, PC-3 cells, fetal human brain tissue, mouse retina tissue Positive IF/ICC detected in: U-251 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1046 Product name: Recombinant human HNRPDL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-415 aa of BC007392 Sequence: KINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein D-like Calculated Molecular Weight: 46 aa, 4 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC007392 Gene Symbol: HNRPDL Gene ID (NCBI): 9987 RRID: AB_3670833 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O14979 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.