Proteintech, 83182-5-RR, SLC38A9 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC38A9 (83182-5-RR) by Proteintech is a Recombinant antibody targeting SLC38A9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83182-5-RR targets SLC38A9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The mTOR complex 1 (mTORC1) protein kinase is a master growth regulator that responds to multiple environmental cues. The lysosomal amino acid transporter SLC38A9 is a physical and functional component of this sensing complex. SLC38A9 (Solute Carrier Family 38 Member 9) was first identified as a potential amino acid transporter belonging to the slc38 family. SLC38A9 has some isoforms: 64,53,57 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15607 Product name: Recombinant human SLC38A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC066891 Sequence: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIPPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMM Predict reactive species Full Name: solute carrier family 38, member 9 Calculated Molecular Weight: 561 aa, 64 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC066891 Gene Symbol: SLC38A9 Gene ID (NCBI): 153129 RRID: AB_3670872 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NBW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.