Proteintech, 83183-4-RR, KLF9 Recombinant monoclonal antibody

Size: 20ul / 100ul The KLF9 (83183-4-RR) by Proteintech is a Recombinant antibody targeting KLF9 in WB, FC (Intra), ELISA applications with reactivity to human samples 83183-4-RR targets KLF9 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, HepG2 cells, A549 cells, U2OS cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Krüppel-like factor 9 (KLF9) was a member of SP/KLF family of DNA-binding transcriptional regulators featured by a highly homologous C-terminal three C2H2-type zinc finger DNA-binding domains. KLF9 has been previously reported to be downregulated in various types of human malignancy and serves as a tumour suppressor at tumour onset and development, affecting cell proliferation, apoptosis, metastasis and tumorigenicity (PMID: 32855660). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34411 Product name: Recombinant human KLF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC074880 Sequence: MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC Predict reactive species Full Name: Kruppel-like factor 9 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-35 kDa GenBank Accession Number: BC074880 Gene Symbol: KLF9 Gene ID (NCBI): 687 RRID: AB_3670873 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13886 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.