Proteintech, 83279-1-RR, TFPI2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TFPI2 (83279-1-RR) by Proteintech is a Recombinant antibody targeting TFPI2 in WB, ELISA applications with reactivity to Human samples 83279-1-RR targets TFPI2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33467 Product name: Recombinant human TFPI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-190 aa of NM_001271003.1 Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG Predict reactive species Full Name: tissue factor pathway inhibitor 2 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 26-36 kDa GenBank Accession Number: NM_001271003.1 Gene Symbol: TFPI2 Gene ID (NCBI): 7980 RRID: AB_3670948 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P48307 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.