Proteintech, 83362-2-RR, NEDD9 Recombinant monoclonal antibody

Size: 20ul / 100ul The NEDD9 (83362-2-RR) by Proteintech is a Recombinant antibody targeting NEDD9 in WB, IF/ICC, ELISA applications with reactivity to human samples 83362-2-RR targets NEDD9 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, MCF-7 cells, U-251 cells, Raji cells, Jurkat cells Positive IF/ICC detected in: MCF-7 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NEDD9, also known as CASL, HEF1, contains an N-terminal Src homology (SH) 3 domain and an adjacent domain composed of multiple SH2-binding motifs(PMID: 8668148). Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. p105 and p115 are predominantly cytoplasmic and associated with focal adhesions, whereas p55associates with the mitotic spindle(PMID: 9584194). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34170 Product name: Recombinant human NEDD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 227-458 aa of BC040207 Sequence: PSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELF Predict reactive species Full Name: neural precursor cell expressed, developmentally down-regulated 9 Calculated Molecular Weight: 834 aa, 93 kDa Observed Molecular Weight: 105 kDa, 115 kDa GenBank Accession Number: BC040207 Gene Symbol: NEDD9 Gene ID (NCBI): 4739 RRID: AB_3671016 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.