Proteintech, 83377-1-RR, RPL29 Recombinant monoclonal antibody

Size: 20ul / 100ul The RPL29 (83377-1-RR) by Proteintech is a Recombinant antibody targeting RPL29 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83377-1-RR targets RPL29 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, PC-3 cells, U-87 MG cells, C6 cells, NIH/3T3 cells, Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Ribosomal protein L29 (Rpl29) is a component of the large (60S) ribosomal subunit which is abundantly expressed in all cell types, plays a regulatory role in translation efficiency and is essential for protein synthesis (PMID: 17195189). In contrast to adult tissues, RPL29 displays a much more widespread pattern of expression throughout embryonic development, and high levels of RPL29 are found in all developing organs. Several reports showed that RPL29 expression is up-regulated in human carcinomas and constitutes a candidate marker for abnormal growth when overexpressed(PMID: 9788632, 10383165). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34100 Product name: Recombinant human RPL29 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-97 aa of BC008926 Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA Predict reactive species Full Name: ribosomal protein L29 Calculated Molecular Weight: 159 aa, 18 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC008926 Gene Symbol: RPL29 Gene ID (NCBI): 6159 RRID: AB_3671030 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P47914 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.