Proteintech, 83507-2-RR, ZC3H12D Recombinant monoclonal antibody

Size: 20ul / 100ul The ZC3H12D (83507-2-RR) by Proteintech is a Recombinant antibody targeting ZC3H12D in WB, FC (Intra), ELISA applications with reactivity to human samples 83507-2-RR targets ZC3H12D in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21770 Product name: Recombinant human ZC3H12D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC157832 Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR Predict reactive species Full Name: zinc finger CCCH-type containing 12D Calculated Molecular Weight: 527 aa, 58 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC157832 Gene Symbol: ZC3H12D Gene ID (NCBI): 340152 RRID: AB_3671132 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A2A288 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.