Proteintech, 83605-6-RR, SFRS11 Recombinant monoclonal antibody

Size: 20ul / 100ul The SFRS11 (83605-6-RR) by Proteintech is a Recombinant antibody targeting SFRS11 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83605-6-RR targets SFRS11 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HepG2 cells, THP-1 cells, HeLa cells, K-562 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SRS11 (Serine/arginine-rich splicing factor 11) may function in pre-mRNA splicing. It is localized in the cell nucleus and can colocalize with spliceosome components. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24932 Product name: Recombinant human SFRS11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 398-483 aa of BC040436 Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD Predict reactive species Full Name: splicing factor, arginine/serine-rich 11 Calculated Molecular Weight: 483 aa, 53 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC040436 Gene Symbol: SFRS11 Gene ID (NCBI): 9295 RRID: AB_3671218 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q05519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.