Iright
BRAND / VENDOR: Proteintech

Proteintech, 83666-1-RR, SLC30A2 Recombinant monoclonal antibody

CATALOG NUMBER: 83666-1-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SLC30A2 (83666-1-RR) by Proteintech is a Recombinant antibody targeting SLC30A2 in WB, FC (Intra), ELISA applications with reactivity to human samples 83666-1-RR targets SLC30A2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, HeLa cells, NCCIT cells, MCF-7 cells, Caco-2 cells, HEK-293 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and function as a homo- or hetero-dimer to transport Zn into vesicles (PMID: 29476070 ). SLC30A2 has 2 isoforms with the molecular mass of 35 kDa (short isoform) and 41 kDa (long isoform). This antibody detects 2 bands of 35 kDa and 52 kDa ( glycosylation form of the long isoform) (PMID: 14608047, PMID: 28174721). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8232 Product name: Recombinant human SLC30A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 234-323 aa of BC006251 Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD Predict reactive species Full Name: solute carrier family 30 (zinc transporter), member 2 Calculated Molecular Weight: 323 aa, 35 kDa Observed Molecular Weight: 35 kDa and 52 kDa GenBank Accession Number: BC006251 Gene Symbol: SLC30A2 Gene ID (NCBI): 7780 RRID: AB_3671272 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BRI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924