Proteintech, 83705-2-RR, MOSC2 Recombinant monoclonal antibody

Size: 20ul / 100ul The MOSC2 (83705-2-RR) by Proteintech is a Recombinant antibody targeting MOSC2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83705-2-RR targets MOSC2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HEK-293 cells, HUVEC cells, mouse kidney tissue, rat liver tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MOSC domain-containing protein 2 (also known as MOSC2), also known as MARC2, is a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. Also, MOSC2 may be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. The reductase activity is regulated under adipogenic conditions, and down-regulation of the terminal component MOSC2 resulted in decreased lipid synthesis, suggesting a possible physiological role of this enzyme system and its component MOSC2 in lipogenesis(PMID: 22203676). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20694 Product name: Recombinant human MOSC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-229 aa of BC011973 Sequence: YENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEK Predict reactive species Full Name: MOCO sulphurase C-terminal domain containing 2 Calculated Molecular Weight: 335 aa, 38 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC011973 Gene Symbol: MOSC2 Gene ID (NCBI): 54996 RRID: AB_3671307 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q969Z3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.