Proteintech, 83794-4-RR, 5 Lipoxygenase Recombinant monoclonal antibody

Size: 20ul / 100ul The 5 Lipoxygenase (83794-4-RR) by Proteintech is a Recombinant antibody targeting 5 Lipoxygenase in WB, IHC, ELISA applications with reactivity to human samples 83794-4-RR targets 5 Lipoxygenase in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, THP-1 cells, human placenta tissue Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ALOX5(arachidonate 5-lipoxygenase) is also named as LOG5, 5-LO and belongs to the lipoxygenase family. It catalyzes the first step in leukotriene biosynthesis, and plays a role in inflammatory processes. It is a 78 kDa iron-containing enzyme that translocates from the cytosol to associate with FLAP, and converts arachidonate in two steps into the unstable intermediate LTA4. It is essential for cysteinyl-leukotriene (cys-LT) production, critical mediators in asthma(PMID:12911785). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19503 Product name: Recombinant human ALOX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC130332 Sequence: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWL Predict reactive species Full Name: arachidonate 5-lipoxygenase Calculated Molecular Weight: 674 aa, 78 kDa Observed Molecular Weight: 70-78 kDa GenBank Accession Number: BC130332 Gene Symbol: 5 Lipoxygenase Gene ID (NCBI): 240 RRID: AB_3671385 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P09917 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.