Proteintech, 83798-6-RR, YAF2 Recombinant monoclonal antibody

Size: 20ul / 100ul The YAF2 (83798-6-RR) by Proteintech is a Recombinant antibody targeting YAF2 in WB, FC (Intra), ELISA applications with reactivity to human samples 83798-6-RR targets YAF2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, Raji cells, HeLa cells, SK-N-SH cells, SH-SY5Y cells, human heart tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information YY1-associated factor 2 (YAF2) is the binding molecule of Yin-Yang-1 (YY-1) protein and plays an important role in transcriptional regulation. YAF-2 mRNA expression was the highest in heart and skeletal muscle (PMID: 11953439). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5023 Product name: Recombinant human YAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC037777 Sequence: MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH Predict reactive species Full Name: YY1 associated factor 2 Calculated Molecular Weight: 204 aa, 23 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC037777 Gene Symbol: YAF2 Gene ID (NCBI): 10138 RRID: AB_3671387 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8IY57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.