Proteintech, 83910-5-RR, FBP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The FBP2 (83910-5-RR) by Proteintech is a Recombinant antibody targeting FBP2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 83910-5-RR targets FBP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information FBP2, also named muscle FBP, belongs to the FBPase class 1 family. FBP2 is a ubiquitously expressed enzyme of glycogen synthesis from non-carbohydrates, e.g., lactate (glyconeogenesis). However, it also plays a variety of non-enzymatic functions. FBP2 is involved in the regulation of hypoxia-inducible factor 1 (Hif1) stability, cell cycle-dependent events, biogenesis of mitochondria, and protection of the organelles against high reactive oxygen species (ROS)- and high Ca2+-induced stress (PMID: 32962293, PMID: 35626746). The calculated molecular weight of FBP2 is 37 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18245 Product name: Recombinant human FBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-339 aa of BC113632 Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS Predict reactive species Full Name: fructose-1,6-bisphosphatase 2 Calculated Molecular Weight: 339 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC113632 Gene Symbol: FBP2 Gene ID (NCBI): 8789 RRID: AB_3671492 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00757 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.