Proteintech, 83961-4-RR, Adiponectin Recombinant monoclonal antibody

Size: 20ul / 100ul The Adiponectin (83961-4-RR) by Proteintech is a Recombinant antibody targeting Adiponectin in WB, ELISA applications with reactivity to human samples 83961-4-RR targets Adiponectin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human adipose tissue, human plasma Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Adiponectin (AdipoQ), an adipocyte-derived hormone, is one of the most abundant adipokines in the blood circulation. Adiponectin modulates a number of metabolic processes, including improving INS sensitivity and anti-inflammatory activity. The role of AdipoQ in reproduction is not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. Adiponectin exerts its effects by activating a range of different signaling molecules via binding to two transmembrane AdipoQ receptors, AdipoR1 and AdipoR2. AdipoR1 is expressed primarily in the skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16304 Product name: Recombinant human ADIPOQ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC096308 Sequence: MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN Predict reactive species Full Name: adiponectin, C1Q and collagen domain containing Calculated Molecular Weight: 244 aa, 26 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC096308 Gene Symbol: Adiponectin Gene ID (NCBI): 9370 RRID: AB_3671542 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q15848 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.