Proteintech, 84031-5-RR, HINT2 Recombinant monoclonal antibody

Size: 20ul / 100ul The HINT2 (84031-5-RR) by Proteintech is a Recombinant antibody targeting HINT2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84031-5-RR targets HINT2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, HuH-7 cells, mouse liver tissue, rat liver tissue, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12413 Product name: Recombinant human HINT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC047737 Sequence: MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG Predict reactive species Full Name: histidine triad nucleotide binding protein 2 Calculated Molecular Weight: 163 aa, 17 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC047737 Gene Symbol: HINT2 Gene ID (NCBI): 84681 RRID: AB_3671598 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BX68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.