Iright
BRAND / VENDOR: Proteintech

Proteintech, 84100-3-RR, ACMSD Recombinant monoclonal antibody

CATALOG NUMBER: 84100-3-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ACMSD (84100-3-RR) by Proteintech is a Recombinant antibody targeting ACMSD in WB, FC (Intra), ELISA applications with reactivity to human samples 84100-3-RR targets ACMSD in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ACMSD (alpha-amino-beta-carboxy-muconate-semialdehyde decarboxylase ) is the key enzyme that regulates the de novo NAD+ synthesis from tryptophan. ACMSD is highly expressed in the liver, kidney and to a lower degree in brain under physiological conditions. The enzyme is primarily cytosolic and is positioned at a critical branching point in the kynurenine pathway, wherein it influences the fate of the precursor 2-amino-3-carboxymuconic-6-semialdehyde (ACMS). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25212 Product name: Recombinant human ACMSD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 47-252 aa of BC016018 Sequence: VSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEE Predict reactive species Full Name: aminocarboxymuconate semialdehyde decarboxylase Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC016018 Gene Symbol: ACMSD Gene ID (NCBI): 130013 RRID: AB_3671665 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8TDX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924