Proteintech, 84101-5-RR, Complement factor B Recombinant monoclonal antibody

Size: 20ul / 100ul The Complement factor B (84101-5-RR) by Proteintech is a Recombinant antibody targeting Complement factor B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84101-5-RR targets Complement factor B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse serum, rat serum, rat plasma, human plasma Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:500 Background Information Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is a 93-100 kDa glycoprotein and is cleaved into Ba (33 kDa) and Bb (60 kDa) by factor D in the presence of C3b (PMID: 11025450). The active subunit Bb is a serine protease that is associated with C3b and forms the alternative pathway for C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0226 Product name: Recombinant human CFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 574-762 aa of BC007990 Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG Predict reactive species Full Name: complement factor B Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 93-100 kDa GenBank Accession Number: BC007990 Gene Symbol: Complement factor B Gene ID (NCBI): 629 RRID: AB_3671666 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P00751 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.