Proteintech, 84174-3-RR, AP2S1 Recombinant monoclonal antibody

Size: 20ul / 100ul The AP2S1 (84174-3-RR) by Proteintech is a Recombinant antibody targeting AP2S1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84174-3-RR targets AP2S1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HEK-293 cells, mouse brain tissue, mouse kidney tissue, rat brain tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information AP2S1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes form clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is composed of two large adaptins (alpha-type subunit AP2A1 or AP2A2 and beta-type subunit AP2B1), a medium adaptin (mu-type subunit AP2M1), and a small adaptin (sigma-type subunit AP2S1). It works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis. Missense mutations of AP2S1 affect Arg15 and lead to familial hypocalciuric hypercalcemia type 3 (FHH3), an extracellular calcium homeostasis disorder affecting the parathyroids, kidneys, and bone (PMID: 23222959). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8095 Product name: Recombinant human AP2S1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC006337 Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE Predict reactive species Full Name: adaptor-related protein complex 2, sigma 1 subunit Calculated Molecular Weight: 142 aa, 17 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC006337 Gene Symbol: AP2S1 Gene ID (NCBI): 1175 RRID: AB_3671731 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P53680 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.