Proteintech, 84312-5-RR, MCTS1 Recombinant monoclonal antibody

Size: 20ul / 100ul The MCTS1 (84312-5-RR) by Proteintech is a Recombinant antibody targeting MCTS1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 84312-5-RR targets MCTS1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information MCTS1 is an anti-oncogene that plays a role in cell cycle regulation. It can reduce cell doubling time and anchor-dependent growth. The G1 transition time and the duration of the G1 / S transition are shortened. It can also promote the release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (PMID: 10440924). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6968 Product name: Recombinant human MCTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC001013 Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK Predict reactive species Full Name: malignant T cell amplified sequence 1 Calculated Molecular Weight: 21 kDa GenBank Accession Number: BC001013 Gene Symbol: MCTS1 Gene ID (NCBI): 28985 RRID: AB_3671853 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9ULC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.