Proteintech, 84993-4-RR, YBX1 Recombinant monoclonal antibody

Size: 20ul / 100ul The YBX1 (84993-4-RR) by Proteintech is a Recombinant antibody targeting YBX1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 84993-4-RR targets YBX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells, MDA-MB-231 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Y box binding protein 1(YBX1) is one of cis-acting elements which has a role in regulation of the expression of HLA class II genes. YBX1 is great of importance in regulation of PTP1B expression. It can bind to splice sites mediate pre-mRNA alternative splicing regulation. Also, it involves the regulation of translation by modulation of the interaction between the mRNA and eukaryotic initiation factors. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation. The calculated molecular weight of YBX1 is 36 kDa, but modified YBX1 is about 36-56 kDa. (PMID: 27384875 ) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14129 Product name: Recombinant human YBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-303 aa of BC010430 Sequence: QGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKET Predict reactive species Full Name: Y box binding protein 1 Calculated Molecular Weight: 324 aa, 36 kDa Observed Molecular Weight: 36-56 kDa GenBank Accession Number: BC010430 Gene Symbol: YBX1 Gene ID (NCBI): 4904 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P67809 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.