Iright
BRAND / VENDOR: Proteintech

Proteintech, 85307-2-RR, CXCL10/IP-10 Recombinant monoclonal antibody

CATALOG NUMBER: 85307-2-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CXCL10/IP-10 (85307-2-RR) by Proteintech is a Recombinant antibody targeting CXCL10/IP-10 in WB, IF/ICC, ELISA applications with reactivity to human samples 85307-2-RR targets CXCL10/IP-10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IFN gamma, LPS and Brefeldin A treated THP-1 cells Positive IF/ICC detected in: IFN gamma, LPS and Brefeldin A treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information CXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2489 Product name: Recombinant Human CXCL10/IP-10 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-98 aa of BC010954 Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Predict reactive species Full Name: chemokine (C-X-C motif) ligand 10 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC010954 Gene Symbol: CXCL10 Gene ID (NCBI): 3627 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02778 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924