Proteintech, 85395-1-RR, PSIP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PSIP1 (85395-1-RR) by Proteintech is a Recombinant antibody targeting PSIP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85395-1-RR targets PSIP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells. Daudi cells, HEK-293T cells, K-562 cells, NIH/3T3 cells, C6 cells Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information PSIP1, also known as PC4 and SRSF1 Interacting Protein 1 or Lens Epithelium-Derived Growth Factor (LEDGF), is a transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. It also plays a role in lens epithelial cell gene regulation and stress responses. It is a chromatin-associated protein with histone chaperone activity, involved in transcriptional elongation. PSIP1 may act as an adapter to coordinate pre-mRNA splicing. PSIP1 encodes two protein isoforms with molecular masses of 52 and 75 kDa. p52 and p75 were identified as interacting with transcription factor PC4 and shown to act as transcriptional coactivators. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21886 Product name: Recombinant human PSIP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 104-324 aa of BC064135 Sequence: ASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEHQTTCNLQ Predict reactive species Full Name: PC4 and SFRS1 interacting protein 1 Calculated Molecular Weight: 530 aa, 60 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC064135 Gene Symbol: PSIP1 Gene ID (NCBI): 11168 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75475 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.