Proteintech, 85773-4-RR, TOMM40 Recombinant monoclonal antibody

Size: 20ul / 100ul The TOMM40 (85773-4-RR) by Proteintech is a Recombinant antibody targeting TOMM40 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85773-4-RR targets TOMM40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13065 Product name: Recombinant human TOMM40 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-361 aa of BC017224 Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG Predict reactive species Full Name: translocase of outer mitochondrial membrane 40 homolog (yeast) Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC017224 Gene Symbol: TOMM40 Gene ID (NCBI): 10452 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O96008 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.