Proteintech, 85851-4-RR, PDRG1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PDRG1 (85851-4-RR) by Proteintech is a Recombinant antibody targeting PDRG1 in WB, IHC, ELISA applications with reactivity to human, rat samples 85851-4-RR targets PDRG1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, HeLa cells, A549 cells, MCF-7 cells, rat liver tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information PDRG1 codes for a novel protein called p53 and DNA damage-regulated protein 1. Human PDRG1 is predominantly expressed in normal testis and its expression can be induced by UV irradiation and be repressed by p53 [PMID14562055]. Recently, PDRG1 was identified as a novel tumor marker for multiple malignancies that is selectively regulated by genotoxic stress. Its expression was upregulated in multiple malignancies including cancers of the colon, rectum, ovary, lung, stomach, breast and uterus when compared to normal tissues [PMID: 21193842], suggesting its being a novel tumor marker that could play a role in cancer development and/or progression. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9109 Product name: Recombinant human PDRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC009334 Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG Predict reactive species Full Name: p53 and DNA damage regulated 1 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 15-16 kDa GenBank Accession Number: BC009334 Gene Symbol: PDRG1 Gene ID (NCBI): 81572 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NUG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.