Proteintech, 85900-1-RR, LAYN Recombinant monoclonal antibody

Size: 20ul / 100ul The LAYN (85900-1-RR) by Proteintech is a Recombinant antibody targeting LAYN in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85900-1-RR targets LAYN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, HeLa cells, A549 cells, NCI-H1299 cells, A172 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information LAYN acts as a receptor for hyaluronic acid (HA) and is involved in various cellular processes, including cell adhesion, movement, and signal transduction. In the context of cancer, LAYN has been identified as a prognostic biomarker. High expression of LAYN is associated with poor prognosis and increased immune cell infiltration in various cancers, such as colorectal cancer and gastric cancer. It may also play a role in T-cell exhaustion and the regulation of tumor-associated macrophages (PMID: 30761122). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14508 Product name: Recombinant human LAYN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-374 aa of BC025407 Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY Predict reactive species Full Name: layilin Calculated Molecular Weight: 382 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC025407 Gene Symbol: LAYN Gene ID (NCBI): 143903 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6UX15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.