Proteintech, 86725-1-RR, IRG1 Recombinant monoclonal antibody

Size: 20ul / 100ul The IRG1 (86725-1-RR) by Proteintech is a Recombinant antibody targeting IRG1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 86725-1-RR targets IRG1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LPS treated RAW 264.7 cells, IFN gamma and LPS treated THP-1 cells Positive IF/ICC detected in: LPS treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information The host Immune-Responsive Gene 1 (IRG1; also called Acod1) is a mitochondrial enzyme induced under inflammatory conditions that produces the metabolite itaconate by decarboxylating cis-aconitate, a TCA cycle intermediate. Gene expression profiling studies of murine macrophages and microglial cells have revealed that IRG1 is highly expressed under pro-inflammatory conditions. Furthermore, IRG1 is highly expressed in the pregnant uterus during the early events leading to implantation, the specific phase of pregnancy in which high levels of inflammatory cytokines are secreted. IRG1 localizes to the mitochondria and may represent a key link between immunological and metabolic processes. IRG1 has crucial functions in embryonic implantation and neurodegeneration. Also, IRG1 promotes endotoxin tolerance by increasing A20 expression in macrophages via increased ROS production. (PMID: 25640654) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28913 Product name: Recombinant human IRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-481 aa of NM_001258406 Sequence: DAAASVRKHLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSFHECQINRPQVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEEKFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNLS Predict reactive species Full Name: immunoresponsive 1 homolog (mouse) Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: NM_001258406 Gene Symbol: IRG1 Gene ID (NCBI): 730249 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A6NK06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.